PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906632.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 788aa    MW: 88218.4 Da    PI: 5.2678
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906632.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox45.21.6e-14646697556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++f +  ++ L + F++n+yps+e++e+LA +lg+t rq+  WF N R  ++
  XP_010906632.1 646 RRFDPVVTQKLHDSFKENQYPSRETKERLAIELGMTSRQIGKWFENARHSMR 697
                     57899999****************************************8876 PP

2PHD40.94.7e-14246301151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++     +++++lCdg C++ fH+kCl+++l se++p+g   wlC+ C++k
  XP_010906632.1 246 FCAKCSSkdLSVDNDIILCDGaCDRGFHQKCLDPPLLSENIPSGdeGWLCPACDCK 301
                     6999*9955445********66*********************9*9*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.32E-14236304IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.0E-12240301IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.119244301IPR019787Zinc finger, PHD-finger
PfamPF006281.9E-11246301IPR019787Zinc finger, PHD-finger
SMARTSM002494.9E-10246299IPR001965Zinc finger, PHD-type
CDDcd155049.08E-29246298No hitNo description
PROSITE patternPS013590247298IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.847639699IPR001356Homeobox domain
SMARTSM003896.4E-13642703IPR001356Homeobox domain
SuperFamilySSF466897.27E-13645704IPR009057Homeodomain-like
CDDcd000866.64E-13645697No hitNo description
PfamPF000467.3E-12647697IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-14647704IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MDRLDIVSPV GYRDHNSNDV CHGQNFRHQE QGLKSEGIEN DSTEVGRADS NHVDSDKLTT  60
LAEHDKSIKP NSQKADMKHG AKKNSKRTLQ KGKKASQSLR GKRYFLRSSL DGVRVLRSMS  120
KGKSKTPAES VTPPVNPTTK RRKRRGKVKG ASKDEFSLTR KRVRYLLTRI NYEQSLIDAY  180
SSEGWKGQSL EKLRPEKELE RAKSEILRCK LKIRDSFRCL DSLLSAGRLQ ESLFDSDGQI  240
CSEDIFCAKC SSKDLSVDND IILCDGACDR GFHQKCLDPP LLSENIPSGD EGWLCPACDC  300
KVDCIDLLSE FQGSSDLSIE DSWEKVFPEA AAIANSDKQY DLSNLPSDDS EDDNYDPDVL  360
EVDTEDHMEE SSSEEDHEEQ SSSEESYFTY SSEDSGPSEK RKHYEDIGLS SDDSEDDDYD  420
PEGPDPDKEI QKESSGSDES DFTSDSDDFC AELSKSGGTD EVSASSLPNL KPLEPSGEGE  480
RVSDRNENAT NSEQPSMLEP DPSQKNALPV SGKRQRDRLD YKKLYDETYG KASSDSSDDE  540
DWSDKNALKK GKKDDHVEET DVLKARSKST ENYRSSGRAK RKATVENIVT KSDLVQKQVL  600
LATSEDTPKK AYQQKLQSAS LHHTQKHDDP WEPDSNGDGA TTSVQRRFDP VVTQKLHDSF  660
KENQYPSRET KERLAIELGM TSRQIGKWFE NARHSMRVSA KEANHAVVST PEEGTSSTKA  720
KGNNDKPDKG GVRNYASNGS KGKKSVGERN DEVGAGRDTS SGEKRKDTQE NNRKKAIERE  780
LRKRRKSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1763785KRKDTQENNRKKAIERELRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906632.10.0PREDICTED: homeobox protein HOX1A isoform X2
RefseqXP_010906633.10.0PREDICTED: homeobox protein HOX1A isoform X2
TrEMBLK3Z4970.0K3Z497_SETIT; Uncharacterized protein
STRINGSi021365m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-74Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain